SCOPe 2.08: Domain d4b30a_: 4b30 A:

Lineage for d4b30a_ (4b30 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Anthomedusae sp. [TaxId:328397] [194158] (5 PDB entries)

8. Domain d4b30a_: 4b30 A: [201561]
   automated match to d4b30b_
   complexed with cl, gol, na, so4; mutant

Details for d4b30a_

PDB Entry: 4b30, 2.1 Å

PDB Description: structure of the mutant v44a of the fluorescent protein killerred

PDB Compounds: (A:) KillerRed

SCOPe Domain Sequences for d4b30a_:

Sequence; same for both SEQRES and ATOM records:

>d4b30a_ d.22.1.0 (A:) automated matches {Anthomedusae sp. [TaxId: 328397]}
eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnahavcetgklpmswkpic
hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvprits

Timeline for d4b30a_:

• d4b30a_ first appeared in SCOPe 2.03
  
• d4b30a_ appears in SCOPe 2.07