SCOPe 2.04: Domain d4b2cd_: 4b2c D:

Lineage for d4b2cd_ (4b2c D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein automated matches [190792] (2 species)
   not a true protein

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries)

8. Domain d4b2cd_: 4b2c D: [201560]
   Other proteins in same PDB: d4b2ca_, d4b2cc_
   automated match to d4b2bb_
   complexed with ca, cl, edo, gol

Details for d4b2cd_

PDB Entry: 4b2c, 1.43 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tpa) in complex with eglin c

PDB Compounds: (D:) eglin c

SCOPe Domain Sequences for d4b2cd_:

Sequence; same for both SEQRES and ATOM records:

>d4b2cd_ d.40.1.1 (D:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
gtefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpg
tnvvnhvphvg

Timeline for d4b2cd_:

• d4b2cd_ first appeared in SCOPe 2.03
  
• d4b2cd_ appears in SCOPe 2.05
  
• d4b2cd_ appears in the current release, SCOPe 2.08, called d4b2cd1