SCOPe 2.08: Domain d4b2cd1: 4b2c D:1-70

Lineage for d4b2cd1 (4b2c D:1-70)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein automated matches [190792] (4 species)
   not a true protein

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries)

8. Domain d4b2cd1: 4b2c D:1-70 [201560]
   Other proteins in same PDB: d4b2ca_, d4b2cb2, d4b2cc_, d4b2cd2
   automated match to d4b2bb_
   complexed with ca, cl, edo, gol

Details for d4b2cd1

PDB Entry: 4b2c, 1.43 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tpa) in complex with eglin c

PDB Compounds: (D:) eglin c

SCOPe Domain Sequences for d4b2cd1:

Sequence; same for both SEQRES and ATOM records:

>d4b2cd1 d.40.1.1 (D:1-70) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
tefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgt
nvvnhvphvg

Timeline for d4b2cd1:

• d4b2cd1 first appeared in SCOPe 2.03, called d4b2cd_
  
• d4b2cd1 appears in SCOPe 2.07