![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
![]() | Protein automated matches [190792] (4 species) not a true protein |
![]() | Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries) |
![]() | Domain d4b2cb1: 4b2c B:1-70 [201559] Other proteins in same PDB: d4b2ca_, d4b2cb2, d4b2cc_, d4b2cd2 automated match to d4b2bb_ complexed with ca, cl, edo, gol |
PDB Entry: 4b2c (more details), 1.43 Å
SCOPe Domain Sequences for d4b2cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b2cb1 d.40.1.1 (B:1-70) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} tefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgt nvvnhvphvg
Timeline for d4b2cb1:
![]() Domains from other chains: (mouse over for more information) d4b2ca_, d4b2cc_, d4b2cd1, d4b2cd2 |