Lineage for d4b2cb_ (4b2c B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410792Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1410793Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1410794Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 1410847Protein automated matches [190792] (2 species)
    not a true protein
  7. 1410850Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries)
  8. 1410853Domain d4b2cb_: 4b2c B: [201559]
    Other proteins in same PDB: d4b2ca_, d4b2cc_
    automated match to d4b2bb_
    complexed with ca, cl, edo, gol

Details for d4b2cb_

PDB Entry: 4b2c (more details), 1.43 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tpa) in complex with eglin c
PDB Compounds: (B:) eglin c

SCOPe Domain Sequences for d4b2cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b2cb_ d.40.1.1 (B:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
gtefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpg
tnvvnhvphvg

SCOPe Domain Coordinates for d4b2cb_:

Click to download the PDB-style file with coordinates for d4b2cb_.
(The format of our PDB-style files is described here.)

Timeline for d4b2cb_: