Lineage for d4b2ad_ (4b2a D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188855Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2188856Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2188857Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 2188910Protein automated matches [190792] (4 species)
    not a true protein
  7. 2188919Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries)
  8. 2188928Domain d4b2ad_: 4b2a D: [201558]
    Other proteins in same PDB: d4b2aa_, d4b2ac_
    automated match to d4b2ab_
    complexed with ca, edo, gol

Details for d4b2ad_

PDB Entry: 4b2a (more details), 1.89 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tga) in complex with eglin c
PDB Compounds: (D:) eglin c

SCOPe Domain Sequences for d4b2ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b2ad_ d.40.1.1 (D:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
selksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvvn
hvphvg

SCOPe Domain Coordinates for d4b2ad_:

Click to download the PDB-style file with coordinates for d4b2ad_.
(The format of our PDB-style files is described here.)

Timeline for d4b2ad_: