Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
Protein automated matches [190792] (2 species) not a true protein |
Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [193615] (5 PDB entries) |
Domain d4b1td_: 4b1t D: [201552] Other proteins in same PDB: d4b1ta_, d4b1tc_ automated match to d4b1tb_ complexed with ca, edo, gol |
PDB Entry: 4b1t (more details), 1.78 Å
SCOPe Domain Sequences for d4b1td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b1td_ d.40.1.1 (D:) automated matches {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} gselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvv nhvphvg
Timeline for d4b1td_: