Lineage for d4b0mm2 (4b0m M:148-235)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 1776152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1776153Protein Caf1m [89221] (1 species)
    chaperone of F1 capsule antigen Caf1
  7. 1776154Species Yersinia pestis [TaxId:632] [89222] (8 PDB entries)
  8. 1776156Domain d4b0mm2: 4b0m M:148-235 [201551]
    Other proteins in same PDB: d4b0ma_, d4b0mb_, d4b0mm1
    automated match to d1p5va2

Details for d4b0mm2

PDB Entry: 4b0m (more details), 1.8 Å

PDB Description: complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis
PDB Compounds: (M:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4b0mm2:

Sequence, based on SEQRES records: (download)

>d4b0mm2 b.7.2.1 (M:148-235) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvtl

Sequence, based on observed residues (ATOM records): (download)

>d4b0mm2 b.7.2.1 (M:148-235) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagnvswriindqggldrlysknvtl

SCOPe Domain Coordinates for d4b0mm2:

Click to download the PDB-style file with coordinates for d4b0mm2.
(The format of our PDB-style files is described here.)

Timeline for d4b0mm2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b0mm1