SCOPe 2.08: Domain d4b0mm2: 4b0m M:148-235

Lineage for d4b0mm2 (4b0m M:148-235)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein Caf1m [89221] (1 species)
   chaperone of F1 capsule antigen Caf1

7. Species Yersinia pestis [TaxId:632] [89222] (8 PDB entries)

8. Domain d4b0mm2: 4b0m M:148-235 [201551]
   Other proteins in same PDB: d4b0ma_, d4b0mb_, d4b0mm1
   automated match to d1p5va2

Details for d4b0mm2

PDB Entry: 4b0m, 1.8 Å

PDB Description: complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis

PDB Compounds: (M:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4b0mm2:

Sequence, based on SEQRES records:

>d4b0mm2 b.7.2.1 (M:148-235) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvtl

Sequence, based on observed residues (ATOM records):

>d4b0mm2 b.7.2.1 (M:148-235) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagnvswriindqggldrlysknvtl

Timeline for d4b0mm2:

• d4b0mm2 first appeared in SCOPe 2.03
  
• d4b0mm2 appears in SCOPe 2.07