![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
![]() | Protein Chaperone protein Caf1m [89205] (1 species) |
![]() | Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries) |
![]() | Domain d4b0mm1: 4b0m M:4-147 [201550] Other proteins in same PDB: d4b0ma_, d4b0mb_, d4b0mm2 automated match to d1p5va1 |
PDB Entry: 4b0m (more details), 1.8 Å
SCOPe Domain Sequences for d4b0mm1:
Sequence, based on SEQRES records: (download)
>d4b0mm1 b.1.11.1 (M:4-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} dikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvv tpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpd kdvgvfvqfainncikllvrpnel
>d4b0mm1 b.1.11.1 (M:4-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} dikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekedpfvvtp plfrldakqqnslriaqaggvfprdkeslkwlcvkgippkddkdvgvfvqfainncikll vrpnel
Timeline for d4b0mm1: