SCOPe 2.05: Domain d4b0mm1: 4b0m M:4-147

Lineage for d4b0mm1 (4b0m M:4-147)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Chaperone protein Caf1m [89205] (1 species)

7. Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)

8. Domain d4b0mm1: 4b0m M:4-147 [201550]
   Other proteins in same PDB: d4b0ma_, d4b0mb_, d4b0mm2
   automated match to d1p5va1

Details for d4b0mm1

PDB Entry: 4b0m, 1.8 Å

PDB Description: complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis

PDB Compounds: (M:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4b0mm1:

Sequence, based on SEQRES records:

>d4b0mm1 b.1.11.1 (M:4-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
dikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvv
tpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpd
kdvgvfvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d4b0mm1 b.1.11.1 (M:4-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
dikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekedpfvvtp
plfrldakqqnslriaqaggvfprdkeslkwlcvkgippkddkdvgvfvqfainncikll
vrpnel

Timeline for d4b0mm1:

• d4b0mm1 first appeared in SCOPe 2.03
  
• d4b0mm1 appears in SCOPe 2.04
  
• d4b0mm1 appears in SCOPe 2.06
  
• d4b0mm1 appears in the current release, SCOPe 2.08