SCOPe 2.08: Domain d4b0ma_: 4b0m A:

Lineage for d4b0ma_ (4b0m A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
   pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368)

4. Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families)
   automatically mapped to Pfam PF13954

5. Family b.167.1.0: automated matches [227281] (1 protein)
   not a true family

6. Protein automated matches [227092] (1 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226478] (2 PDB entries)

8. Domain d4b0ma_: 4b0m A: [201549]
   Other proteins in same PDB: d4b0mb_, d4b0mm1, d4b0mm2
   automated match to d1zdva1

Details for d4b0ma_

PDB Entry: 4b0m, 1.8 Å

PDB Description: complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis

PDB Compounds: (A:) F1 capsule-anchoring protein

SCOPe Domain Sequences for d4b0ma_:

Sequence, based on SEQRES records:

>d4b0ma_ b.167.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
aytfdstmldtnsgesidvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkel
lwpclsslqltkygididkypdliksgteqcvdllaiphsdvqfyfnqqklslivppqal
lprfdgimpmqlwdd

Sequence, based on observed residues (ATOM records):

>d4b0ma_ b.167.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
aytfdstmldtnsgesidvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkel
lwpclsslqltkygididkypdlieqcvdllaiphsdvqfyfnqqklslivppqallprf
dgimpmqlwdd

Timeline for d4b0ma_:

• d4b0ma_ first appeared in SCOPe 2.03
  
• d4b0ma_ appears in SCOPe 2.07