Lineage for d4ay9b_ (4ay9 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033866Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)
  6. 3033896Protein automated matches [194842] (2 species)
    not a true protein
  7. 3033900Species Human (Homo sapiens) [TaxId:9606] [194843] (2 PDB entries)
  8. 3033902Domain d4ay9b_: 4ay9 B: [201543]
    automated match to d4ay9h_
    complexed with nag

Details for d4ay9b_

PDB Entry: 4ay9 (more details), 2.5 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor
PDB Compounds: (B:) follitropin subunit beta

SCOPe Domain Sequences for d4ay9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ay9b_ g.17.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfg

SCOPe Domain Coordinates for d4ay9b_:

Click to download the PDB-style file with coordinates for d4ay9b_.
(The format of our PDB-style files is described here.)

Timeline for d4ay9b_: