Lineage for d4ay7b_ (4ay7 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1346035Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 1346076Family c.1.22.0: automated matches [191464] (1 protein)
    not a true family
  6. 1346077Protein automated matches [190717] (3 species)
    not a true protein
  7. 1346086Species Methanosarcina mazei [TaxId:2209] [193418] (2 PDB entries)
  8. 1346088Domain d4ay7b_: 4ay7 B: [201541]
    automated match to d4ay8a_
    complexed with mg, zn

Details for d4ay7b_

PDB Entry: 4ay7 (more details), 1.8 Å

PDB Description: methyltransferase from Methanosarcina mazei
PDB Compounds: (B:) methylcobalamin: coenzyme m methyltransferase

SCOPe Domain Sequences for d4ay7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ay7b_ c.1.22.0 (B:) automated matches {Methanosarcina mazei [TaxId: 2209]}
eftlktrllaalkgepvdkvpvcsvtqtgivelmdvvgapwpeahtnpelmaklalanhe
lsgleavrlpycltvlveamgceinmgtknrqpsvtghpypkdlegaavpadllqrgrip
vvleaikiirekvgpdvpivggmegpvtvasdlvsvksfmkwsikktdlleqaldiatea
siiyanamveagadviaiadpvaspdlmspdsfrqflksrlqkfassvnsvtvlhicgnv
npilsdmadcgfeglsveekigsakkgkevigtrarlvgnvsspftllpgpvdkikaeak
ealeggidvlapgcgiapmtplenvkalvaardefya

SCOPe Domain Coordinates for d4ay7b_:

Click to download the PDB-style file with coordinates for d4ay7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ay7b_: