Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.22: UROD/MetE-like [51726] (3 families) |
Family c.1.22.0: automated matches [191464] (1 protein) not a true family |
Protein automated matches [190717] (3 species) not a true protein |
Species Methanosarcina mazei [TaxId:2209] [193418] (2 PDB entries) |
Domain d4ay7b_: 4ay7 B: [201541] automated match to d4ay8a_ complexed with mg, zn |
PDB Entry: 4ay7 (more details), 1.8 Å
SCOPe Domain Sequences for d4ay7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ay7b_ c.1.22.0 (B:) automated matches {Methanosarcina mazei [TaxId: 2209]} eftlktrllaalkgepvdkvpvcsvtqtgivelmdvvgapwpeahtnpelmaklalanhe lsgleavrlpycltvlveamgceinmgtknrqpsvtghpypkdlegaavpadllqrgrip vvleaikiirekvgpdvpivggmegpvtvasdlvsvksfmkwsikktdlleqaldiatea siiyanamveagadviaiadpvaspdlmspdsfrqflksrlqkfassvnsvtvlhicgnv npilsdmadcgfeglsveekigsakkgkevigtrarlvgnvsspftllpgpvdkikaeak ealeggidvlapgcgiapmtplenvkalvaardefya
Timeline for d4ay7b_: