Lineage for d1yegl1 (1yeg L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740916Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 2740952Domain d1yegl1: 1yeg L:1-107 [20154]
    Other proteins in same PDB: d1yegh1, d1yegh2, d1yegl2
    part of Fab D2.5
    complexed with act, bpn, zn

Details for d1yegl1

PDB Entry: 1yeg (more details), 2 Å

PDB Description: structure of igg2a fab fragment (d2.3) complexed with reaction product
PDB Compounds: (L:) igg2a fab fragment

SCOPe Domain Sequences for d1yegl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yegl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

SCOPe Domain Coordinates for d1yegl1:

Click to download the PDB-style file with coordinates for d1yegl1.
(The format of our PDB-style files is described here.)

Timeline for d1yegl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yegl2