Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
Domain d4awjj_: 4awj J: [201537] Other proteins in same PDB: d4awjb_, d4awjc_, d4awje_, d4awjf_, d4awjh_, d4awji_, d4awjk1, d4awjk2, d4awjl_ automated match to d4awjg_ complexed with act, acy, gol, v6f |
PDB Entry: 4awj (more details), 2.5 Å
SCOPe Domain Sequences for d4awjj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4awjj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4awjj_: