Lineage for d4awjc_ (4awj C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768930Protein automated matches [193392] (1 species)
    not a true protein
  7. 2768931Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 2768936Domain d4awjc_: 4awj C: [201533]
    Other proteins in same PDB: d4awja_, d4awjb_, d4awjd_, d4awje_, d4awjg_, d4awjh_, d4awjj_, d4awjk1, d4awjk2
    automated match to d4awjf_
    complexed with act, acy, gol, v6f

Details for d4awjc_

PDB Entry: 4awj (more details), 2.5 Å

PDB Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4awjc_:

Sequence, based on SEQRES records: (download)

>d4awjc_ b.3.3.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdler

Sequence, based on observed residues (ATOM records): (download)

>d4awjc_ b.3.3.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvpifanitlpvytlkerclqvvrslvkpenyrrldivrsl
yedledhpnvqkdler

SCOPe Domain Coordinates for d4awjc_:

Click to download the PDB-style file with coordinates for d4awjc_.
(The format of our PDB-style files is described here.)

Timeline for d4awjc_: