Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) automatically mapped to Pfam PF00354 |
Protein Serum amyloid P component (SAP) [49952] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries) |
Domain d4avsc_: 4avs C: [201530] automated match to d1saca_ complexed with ca, n7p, nag |
PDB Entry: 4avs (more details), 1.4 Å
SCOPe Domain Sequences for d4avsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4avsc_ b.29.1.5 (C:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa nildwqalnyeirgyviikplvwv
Timeline for d4avsc_:
View in 3D Domains from other chains: (mouse over for more information) d4avsa_, d4avsb_, d4avsd_, d4avse_ |