SCOPe 2.05: Domain d4atfd_: 4atf D:

Lineage for d4atfd_ (4atf D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
   Pfam PF00722
   beta-Glucanase-like

6. Protein automated matches [191047] (7 species)
   not a true protein

7. Species Zobellia galactanivorans [TaxId:63186] [194909] (1 PDB entry)

8. Domain d4atfd_: 4atf D: [201527]
   automated match to d4atfc_
   complexed with na; mutant

Details for d4atfd_

PDB Entry: 4atf, 1.9 Å

PDB Description: crystal structure of inactivated mutant beta-agarase b in complex with agaro-octaose

PDB Compounds: (D:) beta-agarase B

SCOPe Domain Sequences for d4atfd_:

Sequence; same for both SEQRES and ATOM records:

>d4atfd_ b.29.1.2 (D:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
saddtqeidildaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvekl

Timeline for d4atfd_:

• d4atfd_ first appeared in SCOPe 2.03
  
• d4atfd_ appears in SCOPe 2.04
  
• d4atfd_ is called d4atfd1 in SCOPe 2.06
  
• d4atfd_ appears in the current release, SCOPe 2.08, called d4atfd1