SCOPe 2.08: Domain d4asuc3: 4asu C:380-510

Lineage for d4asuc3 (4asu C:380-510)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
   Uniprot P19483

8. Domain d4asuc3: 4asu C:380-510 [201521]
   Other proteins in same PDB: d4asua1, d4asua2, d4asub1, d4asub2, d4asuc1, d4asuc2, d4asud1, d4asud2, d4asud3, d4asue1, d4asue2, d4asue3, d4asuf1, d4asuf2, d4asuf3, d4asug_, d4asui_
   automated match to d1w0ja1
   complexed with adp, mg

Details for d4asuc3

PDB Entry: 4asu, 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site

PDB Compounds: (C:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d4asuc3:

Sequence, based on SEQRES records:

>d4asuc3 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records):

>d4asuc3 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafagsdldaatqqllsrgvrltellkqgqyspmaieeq
vaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeiv
tnflagfea

Timeline for d4asuc3:

• d4asuc3 first appeared in SCOPe 2.03
  
• d4asuc3 appears in SCOPe 2.07