SCOP 1.73: Domain d1yefl1: 1yef L:1-107

Lineage for d1yefl1 (1yef L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1yefl1: 1yef L:1-107 [20152]
   Other proteins in same PDB: d1yefh1, d1yefh2, d1yefl2
   part of Fab D2.5
   complexed with pnc, zn

Details for d1yefl1

PDB Entry: 1yef, 2 Å

PDB Description: structure of igg2a fab fragment (d2.3) complexed with substrate analogue

PDB Compounds: (L:) igg2a fab fragment

SCOP Domain Sequences for d1yefl1:

Sequence; same for both SEQRES and ATOM records:

>d1yefl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

Timeline for d1yefl1:

• d1yefl1 first appeared (with stable ids) in SCOP 1.55
  
• d1yefl1 appears in SCOP 1.71
  
• d1yefl1 appears in SCOP 1.75
  
• d1yefl1 appears in the current release, SCOPe 2.08