Lineage for d4asuc1 (4asu C:24-94)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1547881Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1547882Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1547883Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1547884Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 1547887Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 1547899Domain d4asuc1: 4asu C:24-94 [201519]
    Other proteins in same PDB: d4asua2, d4asua3, d4asub2, d4asub3, d4asuc2, d4asuc3, d4asud1, d4asud2, d4asud3, d4asue1, d4asue2, d4asue3, d4asuf1, d4asuf2, d4asuf3, d4asug_, d4asui_
    automated match to d1w0ja2
    complexed with adp, mg

Details for d4asuc1

PDB Entry: 4asu (more details), 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site
PDB Compounds: (C:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d4asuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4asuc1 b.49.1.1 (C:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d4asuc1:

Click to download the PDB-style file with coordinates for d4asuc1.
(The format of our PDB-style files is described here.)

Timeline for d4asuc1: