SCOPe 2.07: Domain d4asub2: 4asu B:95-379

Lineage for d4asub2 (4asu B:95-379)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88775] (15 PDB entries)
   Uniprot P19483

8. Domain d4asub2: 4asu B:95-379 [201517]
   Other proteins in same PDB: d4asua1, d4asua3, d4asub1, d4asub3, d4asuc1, d4asuc3, d4asud1, d4asud2, d4asud3, d4asue1, d4asue2, d4asue3, d4asuf1, d4asuf2, d4asuf3, d4asug_, d4asui_
   automated match to d1e79a3
   complexed with adp, mg

Details for d4asub2

PDB Entry: 4asu, 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site

PDB Compounds: (B:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d4asub2:

Sequence; same for both SEQRES and ATOM records:

>d4asub2 c.37.1.11 (B:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

Timeline for d4asub2:

• d4asub2 first appeared in SCOPe 2.03
  
• d4asub2 appears in SCOPe 2.06
  
• d4asub2 appears in the current release, SCOPe 2.08