![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
![]() | Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries) Uniprot P19483 |
![]() | Domain d4asua3: 4asu A:380-510 [201515] Other proteins in same PDB: d4asua1, d4asua2, d4asub1, d4asub2, d4asuc1, d4asuc2, d4asud1, d4asud2, d4asud3, d4asue1, d4asue2, d4asue3, d4asuf1, d4asuf2, d4asuf3, d4asug_, d4asui_ automated match to d1w0ja1 complexed with adp, mg |
PDB Entry: 4asu (more details), 2.6 Å
SCOPe Domain Sequences for d4asua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4asua3 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d4asua3: