Lineage for d4asua3 (4asu A:380-510)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717311Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2717330Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 2717340Domain d4asua3: 4asu A:380-510 [201515]
    Other proteins in same PDB: d4asua1, d4asua2, d4asub1, d4asub2, d4asuc1, d4asuc2, d4asud1, d4asud2, d4asud3, d4asue1, d4asue2, d4asue3, d4asuf1, d4asuf2, d4asuf3, d4asug_, d4asui_
    automated match to d1w0ja1
    complexed with adp, mg

Details for d4asua3

PDB Entry: 4asu (more details), 2.6 Å

PDB Description: F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the Empty site
PDB Compounds: (A:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d4asua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4asua3 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOPe Domain Coordinates for d4asua3:

Click to download the PDB-style file with coordinates for d4asua3.
(The format of our PDB-style files is described here.)

Timeline for d4asua3: