SCOP 1.73: Domain d1yedb1: 1yed B:1-113

Lineage for d1yedb1 (1yed B:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1yedb1: 1yed B:1-113 [20151]
   Other proteins in same PDB: d1yeda1, d1yeda2, d1yedb2, d1yedh2, d1yedl1, d1yedl2
   part of Fab D2.4
   complexed with pnb

Details for d1yedb1

PDB Entry: 1yed, 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)

PDB Compounds: (B:) igg1 fab fragment (d.2.4)

SCOP Domain Sequences for d1yedb1:

Sequence; same for both SEQRES and ATOM records:

>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
avklqqsgpelvrpgtsvklscktsgyiftsywihwlkqssgqglewiariypgtggtyy
nekfkgkatltadkssstaymqlsslksedsavyfctrwgfttvrenyyamdywgqgtlv
tvss

Timeline for d1yedb1:

• d1yedb1 first appeared (with stable ids) in SCOP 1.55
  
• d1yedb1 appears in SCOP 1.71
  
• d1yedb1 appears in SCOP 1.75
  
• d1yedb1 appears in the current release, SCOPe 2.08