Lineage for d1yedl1 (1yed L:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158132Species Fab D2.4 (mouse), kappa L chain [48830] (1 PDB entry)
  8. 158136Domain d1yedl1: 1yed L:1-107 [20148]
    Other proteins in same PDB: d1yeda2, d1yedb2, d1yedh2, d1yedl2

Details for d1yedl1

PDB Entry: 1yed (more details), 3.1 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.4)

SCOP Domain Sequences for d1yedl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yedl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab D2.4 (mouse), kappa L chain}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskle
sgvpdrftgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

SCOP Domain Coordinates for d1yedl1:

Click to download the PDB-style file with coordinates for d1yedl1.
(The format of our PDB-style files is described here.)

Timeline for d1yedl1: