Lineage for d4aptc1 (4apt C:567-689)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088944Fold b.145: AXH domain [102030] (1 superfamily)
    pseudobarrel; some similarity to OB-fold
  4. 2088945Superfamily b.145.1: AXH domain [102031] (2 families) (S)
    automatically mapped to Pfam PF08517
  5. 2088946Family b.145.1.1: AXH domain [102032] (2 proteins)
  6. 2088953Protein automated matches [196747] (1 species)
    not a true protein
  7. 2088954Species Human (Homo sapiens) [TaxId:9606] [196748] (4 PDB entries)
  8. 2088961Domain d4aptc1: 4apt C:567-689 [201469]
    Other proteins in same PDB: d4apta2, d4aptb2, d4aptc2, d4aptd2
    automated match to d4apta_
    complexed with na

Details for d4aptc1

PDB Entry: 4apt (more details), 2.5 Å

PDB Description: The structure of the AXH domain of ataxin-1.
PDB Compounds: (C:) ataxin-1

SCOPe Domain Sequences for d4aptc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aptc1 b.145.1.1 (C:567-689) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apptlppyfmkgsiiqlangelkkvedlktedfiqsaeisndlkidsstveriedshspg
vaviqfavgehraqvsvevlveypffvfgqgwssccpertsqlfdlpcsklsvgdvcisl
tlk

SCOPe Domain Coordinates for d4aptc1:

Click to download the PDB-style file with coordinates for d4aptc1.
(The format of our PDB-style files is described here.)

Timeline for d4aptc1: