SCOPe 2.07: Domain d4amab1: 4ama B:2-293

Lineage for d4amab1 (4ama B:2-293)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)

8. Domain d4amab1: 4ama B:2-293 [201462]
   Other proteins in same PDB: d4amaa2, d4amab2, d4amac2
   automated match to d4amac_

Details for d4amab1

PDB Entry: 4ama, 2.35 Å

PDB Description: crystal structure of n-acetylneuraminic acid lyase from staphylococcus aureus with the chemical modification thia-lysine at position 165 in complex with pyruvate

PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4amab1:

Sequence; same for both SEQRES and ATOM records:

>d4amab1 c.1.10.0 (B:2-293) automated matches {Staphylococcus aureus [TaxId: 93061]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

Timeline for d4amab1:

• d4amab1 first appeared in SCOPe 2.03, called d4amab_
  
• d4amab1 appears in SCOPe 2.06
  
• d4amab1 appears in the current release, SCOPe 2.08