Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (75 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries) |
Domain d4amaa1: 4ama A:2-293 [201461] Other proteins in same PDB: d4amaa2, d4amab2, d4amac2 automated match to d4amac_ |
PDB Entry: 4ama (more details), 2.35 Å
SCOPe Domain Sequences for d4amaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4amaa1 c.1.10.0 (A:2-293) automated matches {Staphylococcus aureus [TaxId: 93061]} nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnffllerirkaf pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
Timeline for d4amaa1: