Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Blastochloris viridis [TaxId:1079] [193423] (3 PDB entries) |
Domain d4am4a_: 4am4 A: [201460] automated match to d4am4b_ complexed with fe, hem |
PDB Entry: 4am4 (more details), 1.68 Å
SCOPe Domain Sequences for d4am4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4am4a_ a.25.1.1 (A:) automated matches {Blastochloris viridis [TaxId: 1079]} mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf eelmgdeehhidfletqldlvsklglelyaqhhigkldd
Timeline for d4am4a_: