Lineage for d4alxi_ (4alx I:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073887Protein automated matches [190922] (2 species)
    not a true protein
  7. 2073888Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)
  8. 2073941Domain d4alxi_: 4alx I: [201458]
    automated match to d4alxg_
    complexed with 1pe, izn, mg

Details for d4alxi_

PDB Entry: 4alx (more details), 2.3 Å

PDB Description: Crystal Structure of Ls-AChBP complexed with the potent nAChR antagonist DHbE
PDB Compounds: (I:) acetylcholine binding protein

SCOPe Domain Sequences for d4alxi_:

Sequence, based on SEQRES records: (download)

>d4alxi_ b.96.1.1 (I:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d4alxi_ b.96.1.1 (I:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkk

SCOPe Domain Coordinates for d4alxi_:

Click to download the PDB-style file with coordinates for d4alxi_.
(The format of our PDB-style files is described here.)

Timeline for d4alxi_: