Lineage for d4alxd_ (4alx D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333502Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1333503Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1333504Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1333583Protein automated matches [190922] (2 species)
    not a true protein
  7. 1333584Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (9 PDB entries)
  8. 1333592Domain d4alxd_: 4alx D: [201454]
    automated match to d4alxg_
    complexed with 1pe, izn, mg

Details for d4alxd_

PDB Entry: 4alx (more details), 2.3 Å

PDB Description: crystal structure of ls-achbp complexed with the potent nachr antagonist dhbe
PDB Compounds: (D:) acetylcholine binding protein

SCOPe Domain Sequences for d4alxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4alxd_ b.96.1.1 (D:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

SCOPe Domain Coordinates for d4alxd_:

Click to download the PDB-style file with coordinates for d4alxd_.
(The format of our PDB-style files is described here.)

Timeline for d4alxd_: