Lineage for d4alxa_ (4alx A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2084602Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2084696Protein automated matches [190922] (2 species)
    not a true protein
  7. 2084697Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)
  8. 2084742Domain d4alxa_: 4alx A: [201451]
    automated match to d4alxg_
    complexed with 1pe, izn, mg

Details for d4alxa_

PDB Entry: 4alx (more details), 2.3 Å

PDB Description: crystal structure of ls-achbp complexed with the potent nachr antagonist dhbe
PDB Compounds: (A:) acetylcholine binding protein

SCOPe Domain Sequences for d4alxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4alxa_ b.96.1.1 (A:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgrseil

SCOPe Domain Coordinates for d4alxa_:

Click to download the PDB-style file with coordinates for d4alxa_.
(The format of our PDB-style files is described here.)

Timeline for d4alxa_: