SCOP 1.65: Domain d1yech1: 1yec H:1-113

Lineage for d1yech1 (1yec H:1-113)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1yech1: 1yec H:1-113 [20145]
   Other proteins in same PDB: d1yech2, d1yecl1, d1yecl2
   part of Fab D2.3
   complexed with pnb, zn

Details for d1yech1

PDB Entry: 1yec, 1.9 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.3)

SCOP Domain Sequences for d1yech1:

Sequence; same for both SEQRES and ATOM records:

>d1yech1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
emqlqqsgaellrpgtsvklscktsgyiftsywihwvkqrsgqglewiariypgtgstyy
nekfkgkatltadkssstaymqlstlksedsavyfctrwgfipvredyvmdywgqgtlvt
vss

Timeline for d1yech1:

• d1yech1 first appeared (with stable ids) in SCOP 1.55
  
• d1yech1 appears in SCOP 1.63
  
• d1yech1 appears in SCOP 1.67
  
• d1yech1 appears in the current release, SCOPe 2.08