Lineage for d4akzb_ (4akz B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937112Family d.17.4.26: VirB8-like [160029] (2 proteins)
    Pfam PF04335
  6. 2937113Protein Type IV secretion system protein VirB8 [160030] (2 species)
  7. 2937116Species Brucella melitensis [TaxId:29459] [160032] (3 PDB entries)
    Uniprot Q7CEG3 97-235
  8. 2937118Domain d4akzb_: 4akz B: [201443]
    automated match to d4akya_

Details for d4akzb_

PDB Entry: 4akz (more details), 2.25 Å

PDB Description: crystal structure of virb8 from brucella suis
PDB Compounds: (B:) type IV secretion system protein virb8

SCOPe Domain Sequences for d4akzb_:

Sequence, based on SEQRES records: (download)

>d4akzb_ d.17.4.26 (B:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpe

Sequence, based on observed residues (ATOM records): (download)

>d4akzb_ d.17.4.26 (B:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtdgetthwiatigyqyvnpslmsesarltn
plgfnvtsyrvdpe

SCOPe Domain Coordinates for d4akzb_:

Click to download the PDB-style file with coordinates for d4akzb_.
(The format of our PDB-style files is described here.)

Timeline for d4akzb_: