SCOP 1.57: Domain d1yecl1: 1yec L:1-107

Lineage for d1yecl1 (1yec L:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab D2.3 (mouse), kappa L chain [48829] (4 PDB entries)

8. Domain d1yecl1: 1yec L:1-107 [20144]
   Other proteins in same PDB: d1yech2, d1yecl2

Details for d1yecl1

PDB Entry: 1yec, 1.9 Å

PDB Description: structure of a catalytic antibody igg2a fab fragment (d2.3)

SCOP Domain Sequences for d1yecl1:

Sequence; same for both SEQRES and ATOM records:

>d1yecl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab D2.3 (mouse), kappa L chain}
divmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrlihlvskld
sgvpdritgsgsgtdftlkisrveaadlgvyycvqgthfpytfgggtkleil

Timeline for d1yecl1:

• d1yecl1 first appeared (with stable ids) in SCOP 1.55
  
• d1yecl1 appears in SCOP 1.59
  
• d1yecl1 appears in the current release, SCOPe 2.08