Lineage for d4aihb_ (4aih B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693816Protein automated matches [190294] (6 species)
    not a true protein
  7. 2693839Species Yersinia pseudotuberculosis [TaxId:502800] [193529] (1 PDB entry)
  8. 2693841Domain d4aihb_: 4aih B: [201433]
    automated match to d4aihe_

Details for d4aihb_

PDB Entry: 4aih (more details), 2.4 Å

PDB Description: Crystal structure of RovA from Yersinia in its free form
PDB Compounds: (B:) Transcriptional regulator slyA

SCOPe Domain Sequences for d4aihb_:

Sequence, based on SEQRES records: (download)

>d4aihb_ a.4.5.28 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
estlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqp
slvrtldqleekglitrhtsandrrakriklteqsspiieqvdgvisstrkeilggissd
eiavlsglidklekniiqlqt

Sequence, based on observed residues (ATOM records): (download)

>d4aihb_ a.4.5.28 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
estlgsdlarlvrvwralidhrlkpleltqthwvtlyninrlppeqsqiqlakaigieqp
slvrtldqleekglitrhtakriklteqsspiieqvdgvisstrkeilggissdeiavls
glidklekniiqlqt

SCOPe Domain Coordinates for d4aihb_:

Click to download the PDB-style file with coordinates for d4aihb_.
(The format of our PDB-style files is described here.)

Timeline for d4aihb_: