SCOPe 2.05: Domain d4aiae_: 4aia E:

Lineage for d4aiae_ (4aia E:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.0: automated matches [191469] (1 protein)
   not a true family

6. Protein automated matches [190736] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187912] (2 PDB entries)

8. Domain d4aiae_: 4aia E: [201431]
   automated match to d4aiac_
   complexed with adk, so4, zn

Details for d4aiae_

PDB Entry: 4aia, 1.8 Å

PDB Description: The structural basis of 3-methyladenine recognition by 3- methyladenine DNA glycosylase I (TAG) from Staphylococcus aureus

PDB Compounds: (E:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d4aiae_:

Sequence; same for both SEQRES and ATOM records:

>d4aiae_ a.96.1.0 (E:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gamnecafgtkdpvylnyhdhvwgqplydskalfkllalesqhaglswltilkkkeayee
afydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflws
yvngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkd
cpskpkhn

Timeline for d4aiae_:

• d4aiae_ first appeared in SCOPe 2.03
  
• d4aiae_ appears in SCOPe 2.04
  
• d4aiae_ is called d4aiae1 in SCOPe 2.06
  
• d4aiae_ appears in the current release, SCOPe 2.08, called d4aiae1