![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
![]() | Family a.96.1.0: automated matches [191469] (1 protein) not a true family |
![]() | Protein automated matches [190736] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [187912] (2 PDB entries) |
![]() | Domain d4aiae1: 4aia E:1-186 [201431] Other proteins in same PDB: d4aiaa2, d4aiad2, d4aiae2 automated match to d4aiac_ complexed with adk, so4, zn |
PDB Entry: 4aia (more details), 1.8 Å
SCOPe Domain Sequences for d4aiae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aiae1 a.96.1.0 (E:1-186) automated matches {Staphylococcus aureus [TaxId: 1280]} mnecafgtkdpvylnyhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp skpkhn
Timeline for d4aiae1: