SCOPe 2.08: Domain d4aiaa1: 4aia A:1-186

Lineage for d4aiaa1 (4aia A:1-186)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.0: automated matches [191469] (1 protein)
   not a true family

6. Protein automated matches [190736] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187912] (2 PDB entries)

8. Domain d4aiaa1: 4aia A:1-186 [201428]
   Other proteins in same PDB: d4aiaa2, d4aiad2, d4aiae2
   automated match to d4aiac_
   complexed with adk, so4, zn

Details for d4aiaa1

PDB Entry: 4aia, 1.8 Å

PDB Description: The structural basis of 3-methyladenine recognition by 3- methyladenine DNA glycosylase I (TAG) from Staphylococcus aureus

PDB Compounds: (A:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d4aiaa1:

Sequence; same for both SEQRES and ATOM records:

>d4aiaa1 a.96.1.0 (A:1-186) automated matches {Staphylococcus aureus [TaxId: 1280]}
mnecafgtkdpvylnyhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf
ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
skpkhn

Timeline for d4aiaa1:

• d4aiaa1 first appeared in SCOPe 2.03, called d4aiaa_
  
• d4aiaa1 appears in SCOPe 2.07