![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
![]() | Family a.96.1.0: automated matches [191469] (1 protein) not a true family |
![]() | Protein automated matches [190736] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:282459] [196040] (2 PDB entries) |
![]() | Domain d4ai5d1: 4ai5 D:1-186 [201426] Other proteins in same PDB: d4ai5a2, d4ai5d2, d4ai5e2 automated match to d4ai5c_ protein/DNA complex; complexed with adk, so4, zn |
PDB Entry: 4ai5 (more details), 2.22 Å
SCOPe Domain Sequences for d4ai5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ai5d1 a.96.1.0 (D:1-186) automated matches {Staphylococcus aureus [TaxId: 282459]} mnecafgtkdpvylnfhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp skpkhn
Timeline for d4ai5d1: