Lineage for d4ai5d1 (4ai5 D:1-186)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721131Family a.96.1.0: automated matches [191469] (1 protein)
    not a true family
  6. 2721132Protein automated matches [190736] (2 species)
    not a true protein
  7. 2721140Species Staphylococcus aureus [TaxId:282459] [196040] (2 PDB entries)
  8. 2721145Domain d4ai5d1: 4ai5 D:1-186 [201426]
    Other proteins in same PDB: d4ai5a2, d4ai5d2, d4ai5e2
    automated match to d4ai5c_
    protein/DNA complex; complexed with adk, so4, zn

Details for d4ai5d1

PDB Entry: 4ai5 (more details), 2.22 Å

PDB Description: crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine
PDB Compounds: (D:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d4ai5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ai5d1 a.96.1.0 (D:1-186) automated matches {Staphylococcus aureus [TaxId: 282459]}
mnecafgtkdpvylnfhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf
ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
skpkhn

SCOPe Domain Coordinates for d4ai5d1:

Click to download the PDB-style file with coordinates for d4ai5d1.
(The format of our PDB-style files is described here.)

Timeline for d4ai5d1: