SCOPe 2.07: Domain d4ai5a1: 4ai5 A:1-186

Lineage for d4ai5a1 (4ai5 A:1-186)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.0: automated matches [191469] (1 protein)
   not a true family

6. Protein automated matches [190736] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282459] [196040] (2 PDB entries)

8. Domain d4ai5a1: 4ai5 A:1-186 [201424]
   Other proteins in same PDB: d4ai5a2, d4ai5d2, d4ai5e2
   automated match to d4ai5c_
   protein/DNA complex; complexed with adk, so4, zn

Details for d4ai5a1

PDB Entry: 4ai5, 2.22 Å

PDB Description: crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine

PDB Compounds: (A:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d4ai5a1:

Sequence; same for both SEQRES and ATOM records:

>d4ai5a1 a.96.1.0 (A:1-186) automated matches {Staphylococcus aureus [TaxId: 282459]}
mnecafgtkdpvylnfhdhvwgqplydskalfkllalesqhaglswltilkkkeayeeaf
ydfepekvaqmtaqdidrlmtfpnivhhrkkleaivnqaqgylkieqaygsfskflwsyv
ngkpkdlqyehasdritvddtatqlskdlkqygfkflgpvtvfsfleaaglydahlkdcp
skpkhn

Timeline for d4ai5a1:

• d4ai5a1 first appeared in SCOPe 2.03, called d4ai5a_
  
• d4ai5a1 appears in SCOPe 2.06