Lineage for d4ag7b_ (4ag7 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575819Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194915] (2 PDB entries)
  8. 2575821Domain d4ag7b_: 4ag7 B: [201423]
    automated match to d4ag7a_
    complexed with coa

Details for d4ag7b_

PDB Entry: 4ag7 (more details), 1.55 Å

PDB Description: C. elegans glucosamine-6-phosphate N-acetyltransferase (GNA1): coenzyme A adduct
PDB Compounds: (B:) glucosamine-6-phosphate n-acetyltransferase

SCOPe Domain Sequences for d4ag7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ag7b_ d.108.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
shifdasvlaphipsnlpdnfkvrplakddfskgyvdllsqltsvgnldqeafekrfeam
rtsvpnyhivviedsnsqkvvasaslvvemkfihgagsrgrvedvvvdtemrrqklgavl
lktlvslgkslgvykislecvpellpfysqfgfqddcnfmtqrf

SCOPe Domain Coordinates for d4ag7b_:

Click to download the PDB-style file with coordinates for d4ag7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ag7b_: