| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d4aein1: 4aei N:1-112 [201420] Other proteins in same PDB: d4aeia_, d4aeib_, d4aeic_, d4aeil2, d4aeim2, d4aein2 automated match to d1blna1 complexed with cl, epe |
PDB Entry: 4aei (more details), 2.3 Å
SCOPe Domain Sequences for d4aein1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aein1 b.1.1.1 (N:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqsplslpvslgdqasiscrssqsivhsngntylewylqkpgqspnlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelk
Timeline for d4aein1: