Lineage for d4aeil2 (4aei L:113-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752560Domain d4aeil2: 4aei L:113-218 [201417]
    Other proteins in same PDB: d4aeia_, d4aeib_, d4aeic_, d4aeih_, d4aeii_, d4aeij_, d4aeil1, d4aeim1, d4aein1
    automated match to d1blna2
    complexed with cl, epe

Details for d4aeil2

PDB Entry: 4aei (more details), 2.3 Å

PDB Description: Crystal structure of the AaHII-Fab4C1 complex
PDB Compounds: (L:) fab antibody light chain

SCOPe Domain Sequences for d4aeil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aeil2 b.1.1.2 (L:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4aeil2:

Click to download the PDB-style file with coordinates for d4aeil2.
(The format of our PDB-style files is described here.)

Timeline for d4aeil2: