Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species) |
Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries) |
Domain d4a6aa_: 4a6a A: [201402] automated match to d4a6al_ complexed with mg, ttp |
PDB Entry: 4a6a (more details), 2.9 Å
SCOPe Domain Sequences for d4a6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a6aa_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]} mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstvgfidp gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps rsyqnfirs
Timeline for d4a6aa_: