SCOPe 2.03: Domain d4a5rb_: 4a5r B:

Lineage for d4a5rb_ (4a5r B:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (6 PDB entries)

8. Domain d4a5rb_: 4a5r B: [201399]
   automated match to d4a5ra_
   complexed with cit, co2, pge, tbe

Details for d4a5rb_

PDB Entry: 4a5r, 2.1 Å

PDB Description: Crystal structure of class A beta-lactamase from Bacillus licheniformis BS3 with tazobactam

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d4a5rb_:

Sequence; same for both SEQRES and ATOM records:

>d4a5rb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkel
rkigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmk
rnttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvvkaln

Timeline for d4a5rb_:

• d4a5rb_ is new in SCOPe 2.03-stable
  
• d4a5rb_ appears in SCOPe 2.04
  
• d4a5rb_ appears in the current release, SCOPe 2.08