Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (19 species) not a true protein |
Species Bacillus licheniformis [TaxId:1402] [188244] (6 PDB entries) |
Domain d4a5rb_: 4a5r B: [201399] automated match to d4a5ra_ complexed with cit, co2, pge, tbe |
PDB Entry: 4a5r (more details), 2.1 Å
SCOPe Domain Sequences for d4a5rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5rb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]} kddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedln qritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkel rkigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmk rnttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdaky ddkliaeatkvvvkaln
Timeline for d4a5rb_: