Lineage for d4a25d_ (4a25 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704244Species Kineococcus radiotolerans [TaxId:131568] [197069] (1 PDB entry)
  8. 2704248Domain d4a25d_: 4a25 D: [201398]
    automated match to d4a25a_
    complexed with cl, mn

Details for d4a25d_

PDB Entry: 4a25 (more details), 2 Å

PDB Description: X-ray structure Dps from Kineococcus radiotolerans in complex with Mn (II) ions.
PDB Compounds: (D:) ferritin dps family protein

SCOPe Domain Sequences for d4a25d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a25d_ a.25.1.0 (D:) automated matches {Kineococcus radiotolerans [TaxId: 131568]}
tihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhlq
ldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalvr
htvdtirrvhdpidaedpasadllhaitlelekqawmigsenrspr

SCOPe Domain Coordinates for d4a25d_:

Click to download the PDB-style file with coordinates for d4a25d_.
(The format of our PDB-style files is described here.)

Timeline for d4a25d_: