Lineage for d4a16d1 (4a16 D:4-543)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2899461Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2899847Protein automated matches [190065] (7 species)
    not a true protein
  7. 2899921Species Mouse (Mus musculus) [TaxId:10090] [187006] (56 PDB entries)
  8. 2900005Domain d4a16d1: 4a16 D:4-543 [201391]
    Other proteins in same PDB: d4a16a2, d4a16b2, d4a16c2, d4a16d2
    automated match to d4a16b_
    complexed with cl, h34, nag, so4

Details for d4a16d1

PDB Entry: 4a16 (more details), 2.65 Å

PDB Description: structure of mouse acetylcholinesterase complex with huprine derivative
PDB Compounds: (D:) acetylcholinesterase

SCOPe Domain Sequences for d4a16d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a16d1 c.69.1.1 (D:4-543) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

SCOPe Domain Coordinates for d4a16d1:

Click to download the PDB-style file with coordinates for d4a16d1.
(The format of our PDB-style files is described here.)

Timeline for d4a16d1: