SCOPe 2.08: Domain d3zxwg2: 3zxw G:151-475

Lineage for d3zxwg2 (3zxw G:151-475)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (16 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [226344] (2 PDB entries)

8. Domain d3zxwg2: 3zxw G:151-475 [201389]
   Other proteins in same PDB: d3zxwa1, d3zxwb_, d3zxwc1, d3zxwd_, d3zxwe1, d3zxwf_, d3zxwg1, d3zxwh_
   automated match to d1wdda1
   complexed with cap, gol, mg

Details for d3zxwg2

PDB Entry: 3zxw, 2.1 Å

PDB Description: structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate

PDB Compounds: (G:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d3zxwg2:

Sequence; same for both SEQRES and ATOM records:

>d3zxwg2 c.1.14.1 (G:151-475) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsqp
fqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimhdfl
tagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhihtgt
vvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhmpal
vdifgddavlqfgggtlghpwgnapgatanrvaleaciqarnegrdlmreggdiireaar
wspelaaacelwkeikfefeaqdti

Timeline for d3zxwg2:

• d3zxwg2 first appeared in SCOPe 2.03
  
• d3zxwg2 appears in SCOPe 2.07