Lineage for d3zxwg2 (3zxw G:151-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838953Species Thermosynechococcus elongatus [TaxId:197221] [226344] (2 PDB entries)
  8. 2838965Domain d3zxwg2: 3zxw G:151-475 [201389]
    Other proteins in same PDB: d3zxwa1, d3zxwb_, d3zxwc1, d3zxwd_, d3zxwe1, d3zxwf_, d3zxwg1, d3zxwh_
    automated match to d1wdda1
    complexed with cap, gol, mg

Details for d3zxwg2

PDB Entry: 3zxw (more details), 2.1 Å

PDB Description: structure of activated rubisco from thermosynechococcus elongatus complexed with 2-carboxyarabinitol-1,5-diphosphate
PDB Compounds: (G:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d3zxwg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxwg2 c.1.14.1 (G:151-475) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
pphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsqp
fqrwrdrflfvadaihkaqaetgeikghylnvtaptceemlkraefakelempiimhdfl
tagftanttlskwcrdngmllhihramhavmdrqknhgihfrvlakclrmsggdhihtgt
vvgklegdkavtlgfvdllrenyieqdrsrgiyftqdwasmpgvmavasggihvwhmpal
vdifgddavlqfgggtlghpwgnapgatanrvaleaciqarnegrdlmreggdiireaar
wspelaaacelwkeikfefeaqdti

SCOPe Domain Coordinates for d3zxwg2:

Click to download the PDB-style file with coordinates for d3zxwg2.
(The format of our PDB-style files is described here.)

Timeline for d3zxwg2: